PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0380s0001.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Trihelix
Protein Properties Length: 297aa    MW: 33848.8 Da    PI: 4.6245
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0380s0001.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix32.42.3e-101996279
             trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstc 79
                         Wt +  l L++    +e + +++ +  ++W  +s+++    ++r+ +qC+ kw++l  +y +ik++e++    ++s +
  Cagra.0380s0001.2.p 19 WTVKDCLILVNEIAAVEADCSNALSSFQKWTMISENCNILDVRRTLNQCRRKWDSLLSDYNQIKKWESRYGGSARSYW 96
                         99999999999999*****************************************************99754444455 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138375.2E-91898No hitNo description
PROSITE profilePS500906.6321975IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MDEGSSGSRR LRSQVAPDWT VKDCLILVNE IAAVEADCSN ALSSFQKWTM ISENCNILDV  60
RRTLNQCRRK WDSLLSDYNQ IKKWESRYGG SARSYWSLST EKRKLLNLPG NVDNELFESI  120
NAVVMIQDDK AGTESDSDPE AQDLVDVTTE LDFVGSKRSR QRTTVTKEIP QQKTKKKEPQ  180
TYRVQENTQQ KPTKATHQNI NMEEKKKTVE EISTDEEEEE TMNIEEDVEV MEVMEAKLSY  240
KIDLIHAIAG RNLAKDNDTG DDISINDKLK YGRQQGDELI SCLSEIVNTL SRLREV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1156161KRSRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284106.10.0hypothetical protein CARUB_v10005240mg
TrEMBLR0GJH30.0R0GJH3_9BRAS; Uncharacterized protein
STRINGAT4G31270.11e-163(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.11e-142sequence-specific DNA binding transcription factors